SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008576757.1.16263 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_008576757.1.16263
Domain Number 1 Region: 27-206
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.53e-40
Family DsbA-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_008576757.1.16263
Sequence length 216
Comment MULTISPECIES: dihydroneopterin aldolase [Xanthomonas]; AA=GCF_001855615.1; RF=na; TAX=366650; STAX=366650; NAME=Xanthomonas alfalfae; strain=GEV-Rose-07; AL=Contig; RT=Major
Sequence
MKLLSRLPLLLMFLLPLVACAADKKAAPVEGEDYTLIDGGQPYAPLAGKVEVTEVFGYTC
PHCAHFEPVLEAWVAKQPAYVRFTPVPAAFGGFWDAFARAYFAADILGVAKRSHRAMFDA
IHEKQTVPTQNVAPEELAAFYAGYGIPQQRFIETYKSEAVEAKLKAAREFALRSKIPGTP
AIIVNGRYLIGARNYPDMLRIADYLIAREHAAPAKR
Download sequence
Identical sequences A0A0G8V9U4 A0A1S1XM88 G2LSA6 Q3BXK3
gi|346723657|ref|YP_004850326.1| WP_008576757.1.100156 WP_008576757.1.100312 WP_008576757.1.10442 WP_008576757.1.11230 WP_008576757.1.12827 WP_008576757.1.13735 WP_008576757.1.14159 WP_008576757.1.16263 WP_008576757.1.17112 WP_008576757.1.19776 WP_008576757.1.199 WP_008576757.1.20169 WP_008576757.1.21303 WP_008576757.1.21317 WP_008576757.1.2230 WP_008576757.1.2259 WP_008576757.1.23534 WP_008576757.1.24172 WP_008576757.1.25231 WP_008576757.1.27112 WP_008576757.1.29361 WP_008576757.1.3003 WP_008576757.1.30677 WP_008576757.1.3440 WP_008576757.1.37569 WP_008576757.1.37942 WP_008576757.1.39371 WP_008576757.1.40690 WP_008576757.1.43396 WP_008576757.1.43419 WP_008576757.1.44794 WP_008576757.1.46449 WP_008576757.1.46677 WP_008576757.1.47244 WP_008576757.1.47958 WP_008576757.1.48351 WP_008576757.1.49886 WP_008576757.1.50405 WP_008576757.1.51091 WP_008576757.1.5224 WP_008576757.1.54158 WP_008576757.1.54709 WP_008576757.1.55770 WP_008576757.1.56262 WP_008576757.1.57452 WP_008576757.1.59767 WP_008576757.1.60785 WP_008576757.1.61221 WP_008576757.1.64411 WP_008576757.1.656 WP_008576757.1.66420 WP_008576757.1.67180 WP_008576757.1.67877 WP_008576757.1.6838 WP_008576757.1.68402 WP_008576757.1.72305 WP_008576757.1.75734 WP_008576757.1.772 WP_008576757.1.77810 WP_008576757.1.78066 WP_008576757.1.79359 WP_008576757.1.79878 WP_008576757.1.80975 WP_008576757.1.81489 WP_008576757.1.85024 WP_008576757.1.85152 WP_008576757.1.86099 WP_008576757.1.89212 WP_008576757.1.89360 WP_008576757.1.94781 WP_008576757.1.94946 WP_008576757.1.96073 WP_008576757.1.9928 WP_008576757.1.99285 316273.XCV0779 gi|78046335|ref|YP_362510.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]