SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008627667.1.82567 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_008627667.1.82567
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.31e-19
Family SMI1/KNR4-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_008627667.1.82567
Sequence length 134
Comment MULTISPECIES: 1,3-beta-glucan synthase regulator [Bacteroidales]; AA=GCF_001039445.1; RF=na; TAX=328812; STAX=328812; NAME=Parabacteroides goldsteinii; strain=910340; AL=Contig; RT=Major
Sequence
MKKELIERLRRFLTAHDMIGTPASDDQILCAEQELGVKFSSDYIDFIKSFGTAYAGMMIN
ALDGNENVVDETKSLREVHPEVTDTYVISDDGSGNPIMINSKGEIEIYYHDSDAEREIIA
LSLEQYIEDNFHEW
Download sequence
Identical sequences A0A0J6C503 F3QV04
WP_008627667.1.102052 WP_008627667.1.59794 WP_008627667.1.67491 WP_008627667.1.82567 WP_008627667.1.95559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]