SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008641942.1.63697 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_008641942.1.63697
Domain Number 1 Region: 3-159
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.16e-60
Family Glutathione peroxidase-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_008641942.1.63697
Sequence length 164
Comment MULTISPECIES: glutathione peroxidase [Cupriavidus]; AA=GCF_000709065.1; RF=na; TAX=119219; STAX=119219; NAME=Cupriavidus metallidurans; strain=NE12; AL=Contig; RT=Major
Sequence
MSNVYQFEANSLSGQPQPLADYRGKVLLIVNTASECGFTPQYAGLQTLQASYQARGFDVL
GFPCNQFGKQEPGDAEQIGAFCESRFHVTFPMFEKIDVNGADAHPLYKWLTSEKRGFLGT
QAIKWNFTKFLLRRDGTVFKRYASTTKPEEIRADIESLLAEQPA
Download sequence
Identical sequences A0A2A4M407 L2EMS4 Q1LJ69
266264.Rmet_2934 gi|94311866|ref|YP_585076.1| WP_008641942.1.12480 WP_008641942.1.22474 WP_008641942.1.25839 WP_008641942.1.38154 WP_008641942.1.52493 WP_008641942.1.63697 WP_008641942.1.64716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]