SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008643086.1.12480 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_008643086.1.12480
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.88e-27
Family Glutathione S-transferase (GST), N-terminal domain 0.0024
Further Details:      
 
Domain Number 2 Region: 73-202
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.27e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_008643086.1.12480
Sequence length 203
Comment MULTISPECIES: stringent starvation protein A [Cupriavidus]; AA=GCF_000196015.1; RF=representative genome; TAX=266264; STAX=119219; NAME=Cupriavidus metallidurans CH34; strain=CH34; AL=Complete Genome; RT=Major
Sequence
MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMNPYGQVPILVERDLIL
YESNIINEYIDERFPHPQLMPADPVQRARARLFLFNFEKELFTHVYVLENEKGKAAEKNH
ERARAAIRDRLTQLAPIFVKNKYMLGEEFSMLDVAIAPLLWRLDHYGIELSKNAAPLLKY
AERIFSRPAYIEALTPSEKVMRR
Download sequence
Identical sequences A0A132HT26 A0A1G6WPJ6 A0A1H0UBL2 A0A1I1Q9U4 A0A2A4MDX1 A0A2E9SGZ2 L2ELU9 Q1LIC7 Q46WN3 U3QMC0
264198.Reut_A3090 266264.Rmet_3227 gi|94312158|ref|YP_585368.1| WP_008643086.1.12480 WP_008643086.1.15076 WP_008643086.1.17806 WP_008643086.1.22474 WP_008643086.1.25839 WP_008643086.1.35671 WP_008643086.1.38154 WP_008643086.1.39732 WP_008643086.1.48002 WP_008643086.1.481 WP_008643086.1.48233 WP_008643086.1.52493 WP_008643086.1.58618 WP_008643086.1.63697 WP_008643086.1.64716 WP_008643086.1.66126 WP_008643086.1.78276 WP_008643086.1.82766 WP_008643086.1.84135 gi|73542774|ref|YP_297294.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]