SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008645582.1.12480 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_008645582.1.12480
Domain Number 1 Region: 15-177
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.73e-34
Family Glutathione peroxidase-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_008645582.1.12480
Sequence length 180
Comment MULTISPECIES: alkyl hydroperoxide reductase [Cupriavidus]; AA=GCF_000196015.1; RF=representative genome; TAX=266264; STAX=119219; NAME=Cupriavidus metallidurans CH34; strain=CH34; AL=Complete Genome; RT=Major
Sequence
MTASAPTRRSPFVLWIIIAIVAAAAGALVAHFALAPKAVSDQAVETLFHTKMPDPAGAEV
DLSKFRGKTLVVNFWAPWCGPCVEEMPELTALHGEYAPRNVEFVGIGIDSASNIQDFLKK
VPVAYPLTVAGFAGTELSRTFGNTQGGLPFTVVITPDGTVKYRKMGRVHADELRAVLPGA
Download sequence
Identical sequences A0A132HD36 A0A2A4M525 L2EI25 Q1LIU2
WP_008645582.1.12480 WP_008645582.1.22474 WP_008645582.1.25839 WP_008645582.1.38154 WP_008645582.1.481 WP_008645582.1.52493 WP_008645582.1.63697 WP_008645582.1.64716 WP_008645582.1.66126 266264.Rmet_3062 gi|94311993|ref|YP_585203.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]