SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008658588.1.40404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_008658588.1.40404
Domain Number - Region: 63-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00863
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_008658588.1.40404
Sequence length 115
Comment MULTISPECIES: hypothetical protein [Bacteroides]; AA=GCF_000598965.1; RF=na; TAX=1339303; STAX=817; NAME=Bacteroides fragilis str. 3986 T(B)13; strain=3986 T(B)13; AL=Contig; RT=Major
Sequence
MKKLKSPASQSEAMKLRWKKRIVFEKGYTESCAEWMAERLEALLDHMQYGHATVAYRKQN
GSFQLVKATLIYYEAEFRKKYDPTKIEGAVVYWNVDEQRWMTFQVENFMEWRPIV
Download sequence
Identical sequences A0A015VTC7 F7LL23
WP_008658588.1.40326 WP_008658588.1.40404 WP_008658588.1.51763 WP_008658588.1.75176 WP_008658588.1.77492 WP_008658588.1.89424 WP_008658588.1.93759 WP_008658588.1.97365 WP_008658588.1.98903 WP_008658588.1.9932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]