SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008703806.1.61664 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_008703806.1.61664
Domain Number - Region: 18-101
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0085
Family Pseudo ankyrin repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_008703806.1.61664
Sequence length 113
Comment MULTISPECIES: plasmid mobilization relaxosome protein MobC [Clostridiales]; AA=GCF_001405455.1; RF=na; TAX=40520; STAX=40520; NAME=Blautia obeum; strain=2789STDY5834861; AL=Contig; RT=Major
Sequence
MSKRTRIHPVQFYLNDDEQYILEEKYRLSRMKSKSAFLRKMILYGFVYEVDYSHIRKMNT
LLGNISSNLNQITHRINSSNTVYQKDLDDIKELMEKIWQLQKSMVSKQPLIKQ
Download sequence
Identical sequences A0A173WE89 A0A174EC02 A0A1C5KSN5 C6J8F9
WP_008703806.1.3573 WP_008703806.1.37309 WP_008703806.1.61664 WP_008703806.1.92233 WP_008703806.1.92979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]