SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009329967.1.86740 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_009329967.1.86740
Domain Number - Region: 25-78
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00575
Family BAR domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_009329967.1.86740
Sequence length 89
Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_001587355.1; RF=na; TAX=1402; STAX=1402; NAME=Bacillus licheniformis; strain=B4164; AL=Scaffold; RT=Major
Sequence
MAEIKVKAEEVKTVFSSLQTKISALSISGSKADISNSSMDVVNKIKKIEKEYEQLLKKYK
EALSSVEKDAWSNIKVLIDTDKNISQKMK
Download sequence
Identical sequences A0A2K7TDM4 Q65D26
WP_009329967.1.12567 WP_009329967.1.1290 WP_009329967.1.20727 WP_009329967.1.21456 WP_009329967.1.22930 WP_009329967.1.27836 WP_009329967.1.34504 WP_009329967.1.34863 WP_009329967.1.35764 WP_009329967.1.42641 WP_009329967.1.47006 WP_009329967.1.54544 WP_009329967.1.55910 WP_009329967.1.62618 WP_009329967.1.719 WP_009329967.1.74244 WP_009329967.1.8120 WP_009329967.1.85389 WP_009329967.1.86740 WP_009329967.1.94809 WP_009329967.1.95031 WP_009329967.1.9558 WP_009329967.1.98374 WP_009329967.1.99505 gi|404491386|ref|YP_006715492.1| gi|52082506|ref|YP_081297.1| 279010.BL00224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]