SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009473107.1.78234 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009473107.1.78234
Domain Number 1 Region: 7-120
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-18
Family BPHL domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_009473107.1.78234
Sequence length 122
Comment MULTISPECIES: hypothetical protein [Rhodococcus]; AA=GCF_000014565.1; RF=representative genome; TAX=101510; STAX=132919; NAME=Rhodococcus jostii RHA1; strain=RHA1; AL=Complete Genome; RT=Major
Sequence
MQTLQPIFDKREQLAQIQSGLLQGESVIAVYDCIGTGTGFVALTDRRVILQDRSFVGNKT
AITSIPYGKIRSVSVVSNKSWAGAFFSGGSIAIDAGKVHTAEFRGMDKSRHVHDVILWHI
TR
Download sequence
Identical sequences J1RBD9 Q0SJF3
WP_009473107.1.53434 WP_009473107.1.60566 WP_009473107.1.78234 101510.RHA1_ro00497 gi|111017519|ref|YP_700491.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]