SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009855054.1.2742 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_009855054.1.2742
Domain Number - Region: 42-100
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0377
Family SMI1/KNR4-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_009855054.1.2742
Sequence length 133
Comment hypothetical protein [Streptococcus gallolyticus]; AA=GCF_000146525.1; RF=na; TAX=545774; STAX=315405; NAME=Streptococcus gallolyticus subsp. gallolyticus TX20005; strain=TX20005; AL=Scaffold; RT=Major
Sequence
MKKFIVVVGCTFGLLFSLLGANGYLVASDVDASTVSHKTGNYTIDKILSSYEDEEFFTKD
YVDEMFNDWSIDENTKVIADEEGGLFYSLTNNHAVLKTYDTDSGQVVEELSLDSPRATTV
GDLKEALYEALEE
Download sequence
Identical sequences A0A0E1XDH1
WP_009855054.1.2742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]