SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009944333.1.58781 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009944333.1.58781
Domain Number 1 Region: 33-147
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.74e-34
Family Thioltransferase 0.0023
Further Details:      
 
Domain Number 2 Region: 174-217
Classification Level Classification E-value
Superfamily TPR-like 0.0000601
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_009944333.1.58781
Sequence length 307
Comment hypothetical protein [Saccharopolyspora erythraea]; AA=GCF_000062885.1; RF=representative genome; TAX=405948; STAX=1836; NAME=Saccharopolyspora erythraea NRRL 2338; strain=NRRL 2338; AL=Complete Genome; RT=Major
Sequence
MAGAVDLSALKSRADATARAGDQQPAAKGEAGAAPPAGGSVIDVTEATFQAEVVERSMQV
PVVVDLWATWCGPCKQLSPMLERLAAEAGGSWVLAKIDVDANPRIAQLFQVQSVPMVIAI
AGGQPVEAFAGAQPEPQIRQWINSLLDAMRDQLPGIREAEAAAGGAAPAEQEDPRFTAAE
EALERGDYAAAESAYQQILESEPANEQAKAALAQVRFSARAESADPSAVERADAAPDDLD
AQLAAADAEVAAQRVEEAFDRLVRTVKRTSGDDRNRVRQHLVEMFELFPDGDERVTAARR
ALASALF
Download sequence
Identical sequences A4FMW6
405948.SACE_6218 WP_009944333.1.17192 WP_009944333.1.58781 WP_009944333.1.76288 gi|134102655|ref|YP_001108316.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]