SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009950020.1.58781 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009950020.1.58781
Domain Number 1 Region: 1-378
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 9.68e-65
Family Gtf glycosyltransferase 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_009950020.1.58781
Sequence length 383
Comment glucosyl transferase [Saccharopolyspora erythraea]; AA=GCF_000062885.1; RF=representative genome; TAX=405948; STAX=1836; NAME=Saccharopolyspora erythraea NRRL 2338; strain=NRRL 2338; AL=Complete Genome; RT=Major
Sequence
MRVLLSSLPAAGHLYPLVPFAWALRCAGHDVLVAAPSDLVPEATATGLPVAAVTDGPIGL
RDLLERLRRLPWFGGDHAILGSLHDFATGADDRSPLTDLVEQTLPGTEALVRDWRPDVVL
RDMADLTGVLACARTGVPFAEHWWGLAAPAPARGELRRIFGDLFARFEARTPPRRALTID
PVPPSFQSDDAPPVYRSRYVPYNGRAERPALPPRSQTPRICLSFGTLLTGDGVSGLAERV
LDAAHRLGAEVVLAADEPPVESHPALLAAGRLPLDQVLASCDALVHHGGSGTMLTALCHG
LPQLVFPHGSDHFVNADRLRSLHLAAVLNARDDPTRVERTLHAVLTDEGMRAGTRKIADE
IAAQPAPADLVPLFEATVEDLAA
Download sequence
Identical sequences A4F7H2
405948.SACE_0652 WP_009950020.1.58781 WP_009950020.1.76288 gi|134097261|ref|YP_001102922.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]