SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009967730.1.12759 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009967730.1.12759
Domain Number 1 Region: 213-352
Classification Level Classification E-value
Superfamily CBS-domain pair 1.89e-27
Family CBS-domain pair 0.0022
Further Details:      
 
Domain Number 2 Region: 363-440
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.000000000000177
Family CorC/HlyC domain-like 0.0033
Further Details:      
 
Weak hits

Sequence:  WP_009967730.1.12759
Domain Number - Region: 176-203
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0589
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_009967730.1.12759
Sequence length 442
Comment MULTISPECIES: membrane protein [Bacillus]; AA=GCF_000385985.1; RF=na; TAX=1315975; STAX=1423; NAME=Bacillus subtilis PS216; strain=PS216; AL=Contig; RT=Major
Sequence
MPSLEKAVVLEFINLLAVAILILLTGFFVAVEFSIVKVRRSKIDQLVAKGKKGAKAAKHV
ITHLDEYLSACQLGITVAALGLGWLGEPTVQTLLRPLFHKAGLNESLTHLLSLVIAFLVV
TYLNVVIGELAPKSFAIQKAESITLLFAKPLIWFYKIMFPFIWLLNHSARLITGVFGLKP
ASEHELAYTEEELRVLLAESYKSGEIRKSELKYMNNIFTFDKRMAKEIMVPRNEMVSLSL
DEDSISNLQETVKQTKYTRYPVVREDKDNVIGVINMKEVLFSMLTKDFSIKKHQIEPFVQ
PVIHVIETIPIYKLLLKMQKERTHMAILIDEYGGTSGLVTVEDIIEEIVGEIRDEFDADE
VPHIRELGKDHYLLNAKLLISDVNSLLGTDLSEAEVDTLGGWFLTQNIDAEPESAIEYDG
YSFKVKDINSHHILFIEVKKAE
Download sequence
Identical sequences A0A164X744 A0A1B2BD50 L8ANK2 P54505
gi|402776737|ref|YP_006630681.1| gi|470162682|ref|YP_007534457.1| NP_390355.1.22788 WP_009967730.1.11257 WP_009967730.1.1140 WP_009967730.1.12759 WP_009967730.1.15902 WP_009967730.1.16291 WP_009967730.1.27660 WP_009967730.1.2914 WP_009967730.1.32219 WP_009967730.1.32420 WP_009967730.1.33846 WP_009967730.1.36189 WP_009967730.1.39605 WP_009967730.1.40859 WP_009967730.1.44184 WP_009967730.1.45019 WP_009967730.1.47157 WP_009967730.1.56274 WP_009967730.1.56411 WP_009967730.1.57201 WP_009967730.1.5726 WP_009967730.1.57513 WP_009967730.1.6139 WP_009967730.1.6517 WP_009967730.1.65223 WP_009967730.1.72999 WP_009967730.1.76977 WP_009967730.1.78686 WP_009967730.1.81116 WP_009967730.1.81747 WP_009967730.1.82722 WP_009967730.1.88042 WP_009967730.1.91723 WP_009967730.1.93420 WP_009967730.1.94199 WP_009967730.1.96043 WP_009967730.1.979 224308.BSU24750 gi|560129427|ref|YP_008830568.1| APC62027 gi|16079531|ref|NP_390355.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]