SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009989546.1.66040 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009989546.1.66040
Domain Number 1 Region: 59-108
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0000902
Family PspA lactotransferrin-binding region 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_009989546.1.66040
Sequence length 112
Comment twin-arginine translocase TatA/TatE family subunit [Sulfolobus solfataricus]; AA=GCF_000968435.1; RF=na; TAX=2287; STAX=2287; NAME=Sulfolobus solfataricus; strain=SULA; AL=Complete Genome; RT=Major
Sequence
MKAKFLISRRDITYKDGSMFNNPYDWVILLVVVAVLFFGASKIPELFRSMGRAVGEFKKG
RVEAEMELQQMQAQNLQQPSVQQQQPNVQDLEKQIAELQKQLEELKKSKQNQ
Download sequence
Identical sequences D0KSH5
gi|384433937|ref|YP_005643295.1| WP_009989546.1.14611 WP_009989546.1.22626 WP_009989546.1.57434 WP_009989546.1.66040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]