SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010073114.1.47838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010073114.1.47838
Domain Number 1 Region: 719-831
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000773
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.056
Further Details:      
 
Weak hits

Sequence:  WP_010073114.1.47838
Domain Number - Region: 368-436
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0262
Family Pentapeptide repeats 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010073114.1.47838
Sequence length 1163
Comment hypothetical protein [Clostridium cellulovorans]; AA=GCF_000145275.1; RF=representative genome; TAX=573061; STAX=1493; NAME=Clostridium cellulovorans 743B; strain=743B; AL=Complete Genome; RT=Major
Sequence
MLQLYDINHNKICGLTNYKDLKIERELSGDENLSFSYPHNDDKYTFIKEECYLRTAQNEY
VIKEINVNDDWTEVVAKVNVEALKGTPFGHFQVNELTLPSATIDSIKKACANTINLALAG
TGWTIGSCNIEKSRTVKKGNCSSYEILQEIRKVYLCDFKFDAINKKVYIYQSMGLDRGSY
FSEELNLKKIEIQSNSYDYCTRIIPLGKDGLKITDINNGKDYVESYQYSNKVISIYWEDN
RYESKESLKEDAIAKLKELSKPVKAYSVEIIDLASISDKYKNILDYDLGDVITLISKDKK
LRDKQRIIKLIEYPDEPERNSCEIANRTLRFEDIQANTLRATEVISSVTTSDGMLEGSKV
NSIDWVQLKNVNIMVADIQDLNAVTARIGTLETTTATITQLNAVNSKIDNLVVTTAQISD
ASITNAKILNAAIDTAKIRAGAITRALIADGAIGTAQIAEASIGTSHISSLTADVFNSGT
IDTSKVTIAGANSRLLIRGNRLQVFAVKSDNSLYERVTLGDVNGDGLVFGFRVRSADGET
VLLDENGVTREGITDGSISNEKIAGDANISGTKLDINSVVTTINSIATTTIQSSKVFLNN
STLDVQFSNLKTTVTEQGQTISTQGAQIVALNNSVVLKVDSQAFSSYKVINDSNITTINS
RLSTAESSLSILQNQITLKVSSTDIEIIKNSIIKVRYIRDWINGSSASIGNHWVEIKAMR
GTTNVAKNKTVTGSSPENTSCPYSRVTDDNTLTTSYANPNLNGGNQYVQIDLGAVYDDID
YLHIWHYYGDSRIYHNNKTEVSSDGTNWITLFDSSKSSEYAETSAGHVVNVNMGRIVNRI
NVAESTIKQNSQDILLKVDVNGVMSAINQSAEAIKIQASKIDLTGYATFTSLSTPGQTTI
NAGNITTGTMNASRISGGTITGALLKTSNTTDYLSIENQNILVYRNSSARIKLGFDMLYN
SGLELGPTDIATTPYLDFHSSGTPSDYDCRIISSGGSSTLGQGVLDITAAAVKLNRQVML
YSSDNTMTSMRCINPAVQRYIEVSTIFGAKGLTYWDSDKRYKMNIEETDKTALDKIMKIK
HYDFDYKAGLKHFDVGYISQQLMEINPQWVITVPQEAANGEVSDFYIPNQTTIIPYLSKA
IQELKQLIDNQNREIKTLKKQLK
Download sequence
Identical sequences D9SSG9
gi|302873697|ref|YP_003842330.1| WP_010073114.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]