SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010074133.1.47838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010074133.1.47838
Domain Number 1 Region: 170-432
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.19e-62
Family beta-glycanases 0.00021
Further Details:      
 
Domain Number 2 Region: 627-746
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.55e-16
Family Family 36 carbohydrate binding module, CBM36 0.021
Further Details:      
 
Domain Number 3 Region: 35-154
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000106
Family Family 6 carbohydrate binding module, CBM6 0.041
Further Details:      
 
Domain Number 4 Region: 887-945
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000111
Family Type I dockerin domain 0.00098
Further Details:      
 
Domain Number 5 Region: 759-879
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000436
Family Family 36 carbohydrate binding module, CBM36 0.04
Further Details:      
 
Domain Number 6 Region: 487-608
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000694
Family Family 6 carbohydrate binding module, CBM6 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010074133.1.47838
Sequence length 946
Comment dockerin [Clostridium cellulovorans]; AA=GCF_000145275.1; RF=representative genome; TAX=573061; STAX=1493; NAME=Clostridium cellulovorans 743B; strain=743B; AL=Complete Genome; RT=Major
Sequence
MVKGRKKAIGCLAMTAAITASTIQMPLVAANAETTATPVRYEAEKATLTGTEVKTGTIFS
NGAGVDGFDTAGDAVTFNVNVEQAGRYNITIGYATPYGQKNNTLVVNGSVISDCVFPASD
TVKQLTVNNISLKAGANTIAIVNSWGWMQVDYIDVQLGEARGPLTPVQPNLVNPYASTST
KALMKYLTDNYGSKIITGQQSGGLDEINYIYSLTGKLPAIQGFDILSGDADIEKAKTWAS
YGGIVELCWHWRAPSGGSDFYTNGTTFDITKAVTPGTAENALILKDIDATAAKLKVLQDA
GIPVLWRPLHEASGGWFWWGAKGAEPLKQLYKILFDKLTNEYKLNNLIWVWTSGTDASAS
TWYPGDAYADIIGVDNYPQTPDHGSFVNSFDTLVALGAKNKLVTMSENGPIPDTDNLQAD
GAAWSYFSTWSGKFIMDEKENTSDLIKKVYTSDYALTLDEIPSASIYGKAPLPVWAAKPL
PTAAPIPEGYTVFEAEKAVLSGLTVDNSNKGYSGTGYVGNFGGATDNLSLNVTVDKGGEY
SLIVRHSAPYGSKEYNVLVNGAVVATNKIQESSLFTDSTAVTVKLTAGANTIKIDRGWGW
FNVDCLMLKPLNGQVIGGPTTQVIPEGYTAYEAENATLTGVEVGNTTKGFSGTGYVTSIT
DDTDKVDFKVNVKEGGTYSLLVRHAAPYGDKAYNVLVNGTQAGTNNITESTEFSNSAELK
IELKAGDNTITIDRGWGWYELDAIMLKALSTRPELTIPEGYTVYEAEKGTLNGTAVATAM
QGFSGTGYVTSFEDDTDNLAMNVNVAAAGTYNLIVRHSAPYGAKEYNVLVNGTAVATNKV
AESTYFSDTTPIEIKLNAGDNTITIDRGWGWFNVDLIMVKPVSVVTTYSLGDVNKDGKVN
AIDLAFVKKAILNGTTDSMDLTVADMNKDGKINAIDLALLKKKLLS
Download sequence
Identical sequences A0A173N050 D9SMC4
gi|302876911|ref|YP_003845544.1| WP_010074133.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]