SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010074830.1.47838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010074830.1.47838
Domain Number 1 Region: 36-439
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.44e-70
Family beta-glycanases 0.00000378
Further Details:      
 
Domain Number 2 Region: 484-542
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000017
Family Type I dockerin domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010074830.1.47838
Sequence length 544
Comment endoglucanase [Clostridium cellulovorans]; AA=GCF_000145275.1; RF=representative genome; TAX=573061; STAX=1493; NAME=Clostridium cellulovorans 743B; strain=743B; AL=Complete Genome; RT=Major
Sequence
MKRLKKLTSIVASLMVASSFCFSTTQVKAAVDTNNDDWLHCKGDKILDKNGNEVWLTGAN
WFGFNCSENVVHGSWYDVKNLMKSIADRGIGLIRIPISSELLCSWMNGTPNPTSSVSADN
SPYHTINADFYDPATKGTKDSMQIFDIMMGYCKELGIKVMVDVHSPHADNSGHTYPLWYG
LETKTAGVITTDKWIDSLTWLVDKYKNDDTILAVDLKNEPHGKRNYKAEIPTDMAKWDDS
TDENNWKYAAEKCSKSVLAANPNILVMIEGVEQTPKYDKGFTYATPDIWQSSDADSPYVR
GWWGGVLSGVKKYPINLGDLNSQVVYSPHDYGPSVYNQVWFDKDFTRQTLLDDYWYNAWA
FIDDQGIAPLLIGEWGGHMDGGKNQKWMELLRDYMIEKRINHTFWCINPNSGDTGGLIGY
DWTTWDEAKYGLLKPALWQDKGKFIGLDHQVKLGSNGMSLNEYFNLTPTDPTDPTDPTNP
TEPIVLPGDVNGDKVVNAMDYAILKKYLLNGSSVTINQANSDLNGDSKVNAIDFAKLKLL
LLSK
Download sequence
Identical sequences A0A173MZX7 D9SRM3
WP_010074830.1.47838 gi|302873521|ref|YP_003842154.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]