SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010075310.1.47838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010075310.1.47838
Domain Number 1 Region: 46-139
Classification Level Classification E-value
Superfamily ICP-like 7.19e-21
Family ICP-like 0.0031
Further Details:      
 
Domain Number 2 Region: 145-237
Classification Level Classification E-value
Superfamily ICP-like 2.35e-19
Family ICP-like 0.0016
Further Details:      
 
Domain Number 3 Region: 254-310
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000441
Family Type I dockerin domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010075310.1.47838
Sequence length 311
Comment proteinase inhibitor [Clostridium cellulovorans]; AA=GCF_000145275.1; RF=representative genome; TAX=573061; STAX=1493; NAME=Clostridium cellulovorans 743B; strain=743B; AL=Complete Genome; RT=Major
Sequence
MLRKKKKFISKVLLVSMCASIVPATVALAEENTATQENVSNGLTPTPTTSQLRGTASISL
KSNATTGYSWTYSIVQGDSIVQTLKGYRSDDTSGTIDGSGGTDFWQFKSVKEGSTTLRFQ
YSRSGENTVAETREFIVTVDNTMNITVKETGKTAQIKLESNPSTGYQWSYIGMQKSVLVE
DSKIYVTAAEQEGKIGSGGTDIWIFRGLQEGPVILEFKYRYPWTGPAIKTKFFKLTVDKE
LNVDVTYLGEPTSQTFNDINGDGKVNLIDFALLKKYLLDNTVVINKDLADRNCDGKINAI
DAALLKKALLA
Download sequence
Identical sequences A0A173MZZ6 D9SNR3
WP_010075310.1.47838 gi|302873065|ref|YP_003841698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]