SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010076218.1.47838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010076218.1.47838
Domain Number 1 Region: 39-412
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.5e-59
Family Pectate lyase-like 0.0000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010076218.1.47838
Sequence length 412
Comment pectate lyase [Clostridium cellulovorans]; AA=GCF_000145275.1; RF=representative genome; TAX=573061; STAX=1493; NAME=Clostridium cellulovorans 743B; strain=743B; AL=Complete Genome; RT=Major
Sequence
MLKSKKILSTMIATLVLSGAIVGNVTTTQNVNAAVSGEKAIGYGANATGGGDTKNIFYVN
TKKELLAAISAKIKDAKGTVITDAPKIIVIQKDINLCSDSTGKEYIPGVSDPKTMPWKSG
SDMASDVIVRVKSNTTLIGKDGGVTLSGGGIKLGTGTNNVVIKNISFEDAYDFFPIWSSN
EWNTELDNMCVEGATNVWIDHCTFSDGKNPEKAKGCTDKNTPIHHDGLLDVKAGADNVSI
SHCLFKDHLKVDLLGSSDKAESKDGGKLHVTFYENYYTNTHERLPRVRFGHVHALNNYYE
ATGQDSIAYVFGMGLKSTLYSEGNIFNLNPTDMANNKTTVMRSMNTGTPTYYFQEAGSIL
NGNVYPTQVLGASKPAYDTTAKPGYSYVPKVVTVSNYKTIAQEIVNNAGAGK
Download sequence
Identical sequences A0A173N0E7 D9SUM3
gi|302874059|ref|YP_003842692.1| WP_010076218.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]