SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010076442.1.47838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010076442.1.47838
Domain Number 1 Region: 529-634
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.91e-19
Family Histidine kinase 0.0063
Further Details:      
 
Domain Number 2 Region: 67-160
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000357
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010076442.1.47838
Sequence length 640
Comment histidine kinase [Clostridium cellulovorans]; AA=GCF_000145275.1; RF=representative genome; TAX=573061; STAX=1493; NAME=Clostridium cellulovorans 743B; strain=743B; AL=Complete Genome; RT=Major
Sequence
MLLYSKIHYLLYEKNKFLVLKTTLSIFIIVLMSVVFSGCTEHQSTDKKPPKAINGKFELS
DWDFQKEGAILLNGQWEFYWNKLLYPEDFNQSTVSHKNHIVAVPTSWRNYQIEDKKLPNE
GYATYRLLVDLDYIPQDLAINTKAFISTCRIWVDNKEIFQTGVVSDNPNTSKDRFKPQLI
TIHPQNKQFYITVQISNFGCAYGGFVTGLELGNIHLLNNENNKQAYVDMFLFGSILIMGL
YHITLYLLRRKDCSTLYFGIICLLIAIRTLLMGQMLLYSFLPSVPLHIFLKLSMITLYLA
LTFFVMFIHIVFPLDTPRWFVRFSQAIGLFFFTTAIIFTEKLGNLFIVPYEIISVFILIV
LLSVLIKAFLKKRESSILVLSAVLFIILIAINDILNSYGVISTGFFIPFGVFIFIFVQSF
MLSRKFAKAFFHEEQLLKSELRMLQAQIKPHFLFNTLNTIICVCRESSEKAEELLLNLSN
YLRCGFSFKNDDEFADLETELLHVKSYLHIEKARFLDKLNIIFDIDTNIHCKVPAYIIQP
IVENSVRHGILPCKDGGTVRLTVKKNNNMLIIIVEDDGVGMTEEKLTALLNSSDKKAGIG
ISNIQNRIQRIYGKSIKIKSTKGIGTIVTLELPLSDALNL
Download sequence
Identical sequences D9ST97
WP_010076442.1.47838 gi|302873844|ref|YP_003842477.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]