SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010076689.1.47838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010076689.1.47838
Domain Number 1 Region: 316-373
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000677
Family Type I dockerin domain 0.0015
Further Details:      
 
Domain Number 2 Region: 198-297
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000254
Family Zinc protease 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010076689.1.47838
Sequence length 374
Comment dockerin [Clostridium cellulovorans]; AA=GCF_000145275.1; RF=representative genome; TAX=573061; STAX=1493; NAME=Clostridium cellulovorans 743B; strain=743B; AL=Complete Genome; RT=Major
Sequence
MKKHKVKCLITSTMVFASLFSSTVITKAEVTSNTSQQNATTTTNQLTLNDMPSNLKSSIE
WVWNNRILKEGSTKRKNLIFDQIYAGKGTLNYIVRWQSNKSVTLQQRKDMATMISRQINN
WTKSLKGYDGWPYGDITVKIVGWACADPSLILNKQSDEIVYTSYITDDLSTTDSSIPTKL
PIAPSSISRFDHFQDSNYSYPGGLDKRFDMYLWGTSNLRGGAGGDWGQRVSDEYILSSLA
SNEAHIIEHEIGHAFSITDFYEDADRPPGGFPTNTIMWAGDSMTITEWDSWMLRYVWSQI
KKDTSRFPATIPVETTYKLGDVNKDGKITALDLAFMKKLILNGTNEADLTLYDMNKDGKF
NALDLATLKRLLLS
Download sequence
Identical sequences A0A173MZR1 D9SS49
gi|302875627|ref|YP_003844260.1| WP_010076689.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]