SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010079121.1.79382 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010079121.1.79382
Domain Number 1 Region: 326-524
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.35e-43
Family Ribonuclease PH domain 1-like 0.000000829
Further Details:      
 
Domain Number 2 Region: 7-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.56e-43
Family Ribonuclease PH domain 1-like 0.000000567
Further Details:      
 
Domain Number 3 Region: 483-582
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.86e-22
Family Ribonuclease PH domain 2-like 0.0000181
Further Details:      
 
Domain Number 4 Region: 153-266
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.03e-22
Family Ribonuclease PH domain 2-like 0.0000141
Further Details:      
 
Domain Number 5 Region: 591-677
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.52e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 6 Region: 655-735
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.58e-16
Family Cold shock DNA-binding domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010079121.1.79382
Sequence length 753
Comment polyribonucleotide nucleotidyltransferase [Micrococcus luteus]; AA=GCF_000180435.1; RF=na; TAX=465515; STAX=1270; NAME=Micrococcus luteus NCTC 2665; strain=type strain: DSM 20030 = NCTC 2665; AL=Contig; RT=Major
Sequence
MEGPEITFAEAVIDNGSYGKRTVRFETGRLAQQAAGAAMVYLDEETSMLSATTVGKSPRE
GFDFFPLTVDVEERMYASGRIPGSFFRREGRPSTDAILTCRLIDRPLRPAFVKGIRNEVQ
VVVTVTSIAPDEIYDTVAINAASLSTQLSGLPFSGPIGGVRMALMDDGSGARQWVAFPKH
SQLKGAVFNMAVAGRVVGDDVAIMMVEAEATPDSWTLVKERGAQAPTEEIVAEGLEAAKP
FIRALCEAQADLVKRAGKDPVDVPVFQDYQDDAYAAVEKLATDRLTEIFSIADKQERESA
SYAYLLEVLEELAGEGKDFAERKGEIAKAYGSLTKQIVRRRILTDQVRIDGRGLTDIRKL
TAEVEVLPRVHGSAIFERGETQIMGVTTLNMLKMEQQIDSLSPETAKRYMHHYNFPPYST
GETGRVGSPKRREIGHGALAERALVPVLPAREEFPYAIRQVSEALSSNGSTSMGSVCAST
LSLLNAGVPLRAHVAGIAMGLVSAEVDGQTQYAALTDILGAEDAFGDMDFKVAGTAEFVT
AIQLDTKLDGIPASVLASALTQAREARLHILSVLNAAIDAPDEMAPTAPRIISVRIPVDK
IGAVIGPKGAMINQIQDDTGADITIEDDGTVLIGATDGASAEAARSAVNAIANPQVPEVG
ERYLGTVVKLTTFGAFVSLTPGKDGLLHVSELRKLNEGKRVDDVEDVLGVGQKVQVEITK
IDDRGKLSLSPVGAESDAVAETADAIESSQTEA
Download sequence
Identical sequences A0A1R4K0M3 C5C9U0
gi|239917238|ref|YP_002956796.1| WP_010079121.1.25715 WP_010079121.1.28443 WP_010079121.1.54265 WP_010079121.1.79382 WP_010079121.1.79589 465515.Mlut_07100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]