SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010468088.1.67183 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010468088.1.67183
Domain Number 1 Region: 4-79
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 6.02e-21
Family F1F0 ATP synthase subunit C 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010468088.1.67183
Sequence length 81
Comment MULTISPECIES: F0F1 ATP synthase subunit C [Acaryochloris]; AA=GCF_000018105.1; RF=representative genome; TAX=329726; STAX=155978; NAME=Acaryochloris marina MBIC11017; strain=MBIC11017; AL=Complete Genome; RT=Major
Sequence
MDPLVAAASVLAAALGIGISTIGPALAQGNAAGKAVEGIARQPEAEGKIRGTLLLCLAFM
ESLTIYGLVIALVLLFANPFA
Download sequence
Identical sequences B0BZK8
WP_010468088.1.53659 WP_010468088.1.67183 gi|158334076|ref|YP_001515248.1| 329726.AM1_0892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]