SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010473270.1.67183 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010473270.1.67183
Domain Number 1 Region: 3-76
Classification Level Classification E-value
Superfamily L28p-like 2.75e-25
Family Ribosomal protein L28 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010473270.1.67183
Sequence length 78
Comment MULTISPECIES: 50S ribosomal protein L28 [Acaryochloris]; AA=GCF_000018105.1; RF=representative genome; TAX=329726; STAX=155978; NAME=Acaryochloris marina MBIC11017; strain=MBIC11017; AL=Complete Genome; RT=Major
Sequence
MGKKCQLTGKKANNAFAVSHSHRRTHKLQEANLQWKRVWWPQEKRWVKLRLSTKAIKTLE
KKGLAAFAREAGINLNQV
Download sequence
Identical sequences B0C811
WP_010473270.1.53659 WP_010473270.1.67183 329726.AM1_2695 gi|158335837|ref|YP_001517011.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]