SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010871028.1.84152 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010871028.1.84152
Domain Number 1 Region: 57-188,335-471
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.88e-53
Family Tandem AAA-ATPase domain 0.0000426
Further Details:      
 
Domain Number 2 Region: 573-693
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 6.7e-30
Family XPF/Rad1/Mus81 nuclease 0.000048
Further Details:      
 
Domain Number 3 Region: 706-774
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000000000000445
Family Hef domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010871028.1.84152
Sequence length 778
Comment RNA helicase [Methanocaldococcus jannaschii]; AA=GCF_000091665.1; RF=representative genome; TAX=243232; STAX=2190; NAME=Methanocaldococcus jannaschii DSM 2661; strain=DSM 2661; AL=Complete Genome; RT=Major
Sequence
MFIEHPLIKPKTLEARLYQQIIAANALKKKTLCVLSTGLGKTAIAILVIAGILTKKDGKV
LILAPSRPLVEQHYNRLKQVLNIDEDKIIALTGKIQPKKRAELYKKGKIFIATPQVIEND
IIAGRINVDEFILLIADEAHHTTGDHAYAFVAKKFKDKCHILGLTASPGSDIDKVMEICE
NLGIEHVEVRTEDDEDVKPYIAKVKLIPIRIDLPNEFKRALKLINEALKERLKILKDAGV
INSIADVTKTELIELNNKLFSYDEEVKYELIKVCSEALKLMHAKELLESQGKSVFLNYIN
KLSMQRTKSAKSIVNDEKVREAVNLLMKSDVEHPKLGKVVDMVKNILEKNKDERIIIFAQ
YRDTVEKIVNLLTQNGIKAIRFIGQANKEGKGMSQKEQIEAIERFKKEGSVLVSTSVSEE
GIDIPSVNYIIFYEPVPSEIRFIQRRGRAMRGEGGKVYVLIAKGTADEAYYRSALYKERE
MKRLLKNMCYLLNKRLQKKFEEKSKEEIKEETEEIKEKEIESKTAVKEETKEEEEKTKKP
VTILDFIKQIEVKERSKSEEDKIKQEIKIPKKPIKIIVDVREKNMAKLLHNYANIELKTL
EVGDYVLSDRVVVERKTAEDFVNSIIDKRLFSQLKNLKKVEKPLLIVEGENFSRLHENAL
KGAILSIILDFGIPIIFTKNAEETADLLIKIAEKEQIKEKRTVMVRYGKTAMSLKEQQKF
IVESLPDVGGALAERLLKHFKTVENVFTAKEEELMKVEGVGKERAKKIREVLTAEYEG
Download sequence
Identical sequences Q58900
IGBMC-0122-000 WP_010871028.1.84152 243232.MJ1505 gi|15669699|ref|NP_248512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]