SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010871188.1.84152 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010871188.1.84152
Domain Number 1 Region: 47-205
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.00000000912
Family MRR-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010871188.1.84152
Sequence length 226
Comment hypothetical protein [Methanocaldococcus jannaschii]; AA=GCF_000091665.1; RF=representative genome; TAX=243232; STAX=2190; NAME=Methanocaldococcus jannaschii DSM 2661; strain=DSM 2661; AL=Complete Genome; RT=Major
Sequence
MNKLKLKNEKEVRIKFGEYKLTGFSSDNGNNLYKLFNLTLSKIRYRKAMLEHNFQLPKIK
ESHKPKEITEKIKENDIYFLELINEIKKDFKDFCSLDAGTLFELFMYYTLIEFFKENNID
AKVIRNLDVSYKGNIFTEIDLFVDVFGKNFIFECKNRHISSNAILKLYGIMKILNINFGV
LASTKGFYGNLKKEDIFKEYNIYILDKLIEKEKNKIFKELKDIFNI
Download sequence
Identical sequences Q59058
243232.MJ1664 WP_010871188.1.84152 gi|15669860|ref|NP_248674.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]