SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010872413.1.1889 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010872413.1.1889
Domain Number 1 Region: 2-314
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.42e-28
Family FAD/NAD-linked reductases, N-terminal and central domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010872413.1.1889
Sequence length 404
Comment NADH dehydrogenase [Synechocystis sp. PCC 6803]; AA=GCF_000340785.1; RF=na; TAX=1148; STAX=1148; NAME=Synechocystis sp. PCC 6803; strain=PCC 6803; AL=Complete Genome; RT=Major
Sequence
MTDARPRICILGGGFGGLYTALRLGQLSWEGHTPPEIVLVDQRDRFLFAPFLYELVTEEM
QTWEIAPPFVELLAESGVIFRQAEVTAIDFDHQKVLLNDQDKGTESLAFDQLVIALGGQT
PLPNLPGLKDYGLGFRTLEDAYKLKQKLKSLEQADAEKIRIAIVGGGYSGVELAAKLGDR
LGERGRIRIIERGKEILAMSPEFNRQQAQASLSAKGIWVDTETTVTAITATDVTLQFREQ
EDVIPVDLVLWTVGTTVSPLIRNLALPHNDQGQLRTNAQLQVEGKTNIFALGDGAEGRDA
SGQLIPTTAQGAFQQTDYCAWNIWANLTGRPLLPCRYQPLGEMLALGTDGAVLSGLGIKL
SGPAALLARRLVYLYRFPTWQHQLTVGLNWLTRPLGDWLKNEPS
Download sequence
Identical sequences L8AIX7 P73735
WP_010872413.1.11876 WP_010872413.1.1889 WP_010872413.1.18904 WP_010872413.1.33690 WP_010872413.1.35395 WP_010872413.1.47586 WP_010872413.1.99424 gi|16330375|ref|NP_441103.1| gi|383322116|ref|YP_005382969.1| gi|383491169|ref|YP_005408845.1| SgR62 1148.slr1743 gi|16330375|ref|NP_441103.1| gi|383325285|ref|YP_005386138.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]