SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010872417.1.99424 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010872417.1.99424
Domain Number 1 Region: 5-343
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.49e-36
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010872417.1.99424
Sequence length 445
Comment pyridine nucleotide-disulfide oxidoreductase [Synechocystis sp. PCC 6803]; AA=GCF_000284135.1; RF=na; TAX=1080228; STAX=1148; NAME=Synechocystis sp. PCC 6803 substr. GT-I; strain=PCC 6803 substr. GT-I; AL=Complete Genome; RT=Major
Sequence
MNSPTSPRRPHVVIVGGGFAGLYTAKNLRRSPVDITLIDKRNFHLFQPLLYQVATGSLSP
ADIASPLRGVLKGQKNIRVLMDKVIDIDPDKQKVVLEDHAPIAYDWLVVATGVSHHYFGN
DHWAALAPGLKTIEDALTIRQRIFAAFEAAEKESNPERQQAWLTFVIVGAGPTGVELAGA
IAEIAHSSLKDNFHRIDTRQAKILLIEGVDRVLPPYKPQLSARAQRDLEDLGVTVLTERM
VTDINPEQVTVHNNGQTETIVTKTVLWGAGVRASSLGKIIGDRTGAELDRAGRVVVNPDL
SVASFDNIFVLGDLANYSHQGDQPLPGVAPVAMQEAAYLSKLIPARLAEKEQIMVPFRYI
DYGSLAVIGQNKAVVDLGFAQFTGLVAWMIWVWAHVYYLIEFDNKLIVMLQWGWNYFTRG
RGARLITDTPNPQSTSTVQKELVRP
Download sequence
Identical sequences L8AHN8 P73739
gi|16330379|ref|NP_441107.1| 1148.slr0851 gi|16330379|ref|NP_441107.1| gi|383325289|ref|YP_005386142.1| gi|383491173|ref|YP_005408849.1| gi|383322120|ref|YP_005382973.1| WP_010872417.1.11876 WP_010872417.1.1889 WP_010872417.1.18904 WP_010872417.1.33690 WP_010872417.1.35395 WP_010872417.1.47586 WP_010872417.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]