SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010872515.1.18904 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010872515.1.18904
Domain Number 1 Region: 4-174,277-362
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.14e-32
Family FAD/NAD-linked reductases, N-terminal and central domains 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010872515.1.18904
Sequence length 425
Comment hypothetical protein [Synechocystis sp. PCC 6803]; AA=GCF_000284215.1; RF=na; TAX=1080229; STAX=1148; NAME=Synechocystis sp. PCC 6803 substr. PCC-N; strain=PCC 6803 substr. PCC-N; AL=Complete Genome; RT=Major
Sequence
MEEFAVVIIGAGPAGGQCARQLAQQGVRVLLVEQHSNFSQNNYSSAASPLETMALFDLPP
GVVARYWRNLAIAATEKEQIWYSDQPRGVVFDFAKLRQFLADTVTKAGGQVWLGHRFWGY
QQVGDGLEVTLRRSSKNSLSSDSVEKVEKVTVKTQVLIDATGSKRAVINCGQPKATDNNQ
YYRGIGTEYLITVDETTHQRFADTLVFFLGYRWSPQGYSWIFPMDNHQLKVGTAIFAGQH
RYLGELKPLRSYTEAIIRDYLKLEKSQYHLEEIHGSVLDYAVNQGDTYHRGSVLAIGDAV
STVNFLGGEGIRHGMQGANIAVPFVADYLRGHVQAFEKYEQAMKAHFAEPWQRTEKLSQR
VYLEFGDRQIDLGVTYLSYLRYDDVLDLLFHYRFDRIYGGITPLLLKKVAQFSQQCRQWL
RKLSP
Download sequence
Identical sequences L8AHY2 P73829
gi|16330478|ref|NP_441206.1| 1148.slr1998 SgR60 gi|383491272|ref|YP_005408948.1| gi|383322219|ref|YP_005383072.1| gi|16330478|ref|NP_441206.1| WP_010872515.1.11876 WP_010872515.1.1889 WP_010872515.1.18904 WP_010872515.1.33690 WP_010872515.1.35395 WP_010872515.1.47586 WP_010872515.1.99424 gi|383325388|ref|YP_005386241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]