SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010872848.1.33690 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010872848.1.33690
Domain Number 1 Region: 191-325
Classification Level Classification E-value
Superfamily CheY-like 3.27e-37
Family CheY-related 0.0012
Further Details:      
 
Domain Number 2 Region: 14-69
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000163
Family Homodimeric domain of signal transducing histidine kinase 0.0037
Further Details:      
 
Weak hits

Sequence:  WP_010872848.1.33690
Domain Number - Region: 455-600
Classification Level Classification E-value
Superfamily PP2C-like 0.000112
Family PP2C-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010872848.1.33690
Sequence length 603
Comment fused two-component system sensor histidine kinase/response regulator/phosphatase [Synechocystis sp. PCC 6803]; AA=GCF_000270265.1; RF=na; TAX=1148; STAX=1148; NAME=Synechocystis sp. PCC 6803; strain=GT-S; AL=Complete Genome; RT=Major
Sequence
MMNPSINSVDIESATAFIRHELRTPINAIVGYGEMVQEELAEANSPLTEEIDTLLVEAQK
LLEIINLFVKHSDGEDKSDFQKLFSTIPHSTNFSITNIILNCDSLLEAEECTNELELTED
IRKIKLAALRLQGLVNNIESIFTNFLESLNPGNGTGLSPDFIFPSSSNTNEISLGNIKTN
GVDSRELLKGKILVVDDNPSNLDLFFQHLTRKGHAVTTCLSAKDALGLLQSQNYDLILLD
LLMPETNGDQFLEYLKTSVEFQHIPVIIVSALDEFESIIRCIEMGAEDFLPKPFDPVLLK
ARIGSSLEKKRLRDQEKLYTQQVEGLSEMMAKELEKGRQMQKNFLPAHLLTRSGWEFSAY
FSPAQQLAGDFYDLFELPGDRLGIVVADVCDKGVGAALFMGLFRSLIRIFSGQAALDGLI
NPSFNLPSGQGLLDVNLDNLLNNINFEPLESIKLINNYVAINHGEASMFATIFFGILEPS
SGKLSYINGGHEPVFIVDSNHQLKTKLTSTGPAVGMLPDLQFKTAEIILQPGDLLLSYTD
GVTEAKSPTGNFFGKEKLLNALGSSFNSVDQLMLNIKESLEEHMGEAQQFDDITLLAIKF
QTT
Download sequence
Identical sequences L8AU23 P74139
1148.slr1983 gi|16330817|ref|NP_441545.1| WP_010872848.1.33690 WP_010872848.1.35395 WP_010872848.1.47586 WP_010872848.1.99424 gi|16330817|ref|NP_441545.1| gi|383322559|ref|YP_005383412.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]