SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010873016.1.1889 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010873016.1.1889
Domain Number 1 Region: 123-292
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 6.67e-58
Family NadC C-terminal domain-like 0.0000145
Further Details:      
 
Domain Number 2 Region: 12-122
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 4.71e-29
Family NadC N-terminal domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010873016.1.1889
Sequence length 295
Comment nicotinate-nucleotide pyrophosphorylase [Synechocystis sp. PCC 6803]; AA=GCF_000340785.1; RF=na; TAX=1148; STAX=1148; NAME=Synechocystis sp. PCC 6803; strain=PCC 6803; AL=Complete Genome; RT=Major
Sequence
MMRILVTNPAPMTCLPPWIIIDPWLQQWLAEDIGRGDWSTQGLGLQHRGQARWVAKENGV
IAGLPMAARIFQLLDPSMEFQVLAGEGQAVTASTVVATMAGNLGSLLTGERVALNLVMGL
SGIATMTRQYVQAIADYPTRFVDTRKTTPGLRVLEKYASRLGGAMNHRLGLDDAVMVKDN
HIQAAGSITKAVQTLRQNLPYPLAIEVETSNLEEVQEAIATQVEIIMLDNMGTDTMATAV
KLIRQANPLIRIEASGNVTLANLTAIASTGVDFISSSAPITRSPWLDLSMQIVRN
Download sequence
Identical sequences P74301
gi|383322730|ref|YP_005383583.1| gi|16330987|ref|NP_441715.1| 1148.slr0936 gi|16330987|ref|NP_441715.1| gi|383491783|ref|YP_005409459.1| WP_010873016.1.11876 WP_010873016.1.1889 WP_010873016.1.18904 WP_010873016.1.33690 WP_010873016.1.35395 WP_010873016.1.47586 WP_010873016.1.99424 gi|383325899|ref|YP_005386752.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]