SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010873384.1.18904 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010873384.1.18904
Domain Number 1 Region: 11-144,214-326
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-17
Family FAD-linked reductases, N-terminal domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010873384.1.18904
Sequence length 498
Comment hypothetical protein [Synechocystis sp. PCC 6803]; AA=GCF_000284215.1; RF=na; TAX=1080229; STAX=1148; NAME=Synechocystis sp. PCC 6803 substr. PCC-N; strain=PCC 6803 substr. PCC-N; AL=Complete Genome; RT=Major
Sequence
MVQVGAAAINRVDVAVIGGGIAGVAIAEYVARHTNLSVQLLEQNSHLGGDSSGKLEGWFH
TGALYSGQDDGQTFFNCVNGVEDLLNHYSHYFAGRCNLTLEQFDHGYRPTVTGAGWFDPN
PVYLIHPQRHSPEMLQSGLKGDRVQLEMQLKRVLGRLEMAYGQQFNWRSPTGNGAVAPDY
DHLESYEQRSCSLLGQSEKISHYCQQFDLSHGVKPSDYALLKSLDCAMDTQGILQDLTAS
ALAHGTAIATGINLEQINVDRYGPVRVQSIFYRDCQGQQHYLKAKAFIFAVGAGFERILP
TLQVRAKLKQSRSTMVVAYPAISSHNFVRMSTKNSYHFNHFFQRANIPDSSEFLNYSMLA
NSGYVSNENDYLASGEIELLLDTAARYFSEENLYQRQLWSYDCVKTEFISDDAQKRRYSY
WIEVNPQSNYLCVLPGKFSFFPTVAVQTLKQLKTILPTEEVDRSHRDYSAHYHQAQALVA
SPYPHQLLASYWKNNANS
Download sequence
Identical sequences L8ARG8 Q55639
WP_010873384.1.11876 WP_010873384.1.1889 WP_010873384.1.18904 WP_010873384.1.33690 WP_010873384.1.35395 WP_010873384.1.47586 WP_010873384.1.99424 gi|383323098|ref|YP_005383951.1| SgR64 gi|383492151|ref|YP_005409827.1| 1148.sll0321 gi|16331357|ref|NP_442085.1| gi|383326267|ref|YP_005387120.1| gi|16331357|ref|NP_442085.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]