SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010873451.1.35395 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010873451.1.35395
Domain Number 1 Region: 12-72,103-268
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.47e-42
Family GidA-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010873451.1.35395
Sequence length 635
Comment tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG [Synechocystis sp. PCC 6803]; AA=GCF_000009725.1; RF=na; TAX=1148; STAX=1148; NAME=Synechocystis sp. PCC 6803; strain=PCC 6803; AL=Complete Genome; RT=Major
Sequence
MTLRSPVEFQDQFDVIVVGAGHAGCEAALATARLGCRTLLLTLNLDRIAWQPCNPAVGGP
AKSQLTHEVDALGGEIGKMADRTYLQKRVLNISRGPAVWALRAQTDKREYAAVMKNIVEN
QPNLSIREGMVTDLVLGDNDEIQGVQTYFGACFGAQSVVITTGTFLGGKIWIGNKSMPAG
RAGEFAAVGLTETLNELGFETGRLKTGTPARVDRRSVDYDKLEPQPPDEQVSWFSFDPEV
WVEREQMNCYLTRTTAKTHQLIKDNLHLSPIYGGFIDSKGPRYCPSIEDKIVRFADKESH
QIFIEPEGRDIPELYIQGFSTGLPENVQLAMLQTLPGLENCVMLRPAYAVEYDFLPATQC
YPSLMTKKVAGLFCAGQINGTTGYEEAAAQGLVAGINAARHCQGKSLIIFSREGSYLGTL
IDDLCTKDLREPYRMLTSRSEYRLILRSDNADQRLTPLGREIGLIDDRRWDLFQTKQANI
TAEKERLYSTRIKEQDAVGKEIVDYTQQKIKGSIVLAELLRRPGFHYPDLEKFQLGNEEL
KPEEKTSVEIEIKYSGYIKRQQTQIEQVSRHSQKRLPPGLNYMAIETLSMEAREKLTQFQ
PLTIGQAGRIGGVNPADINALLVYLETQLRRSVSP
Download sequence
Identical sequences L8ASQ1 Q55694
gi|383492220|ref|YP_005409896.1| gi|16331425|ref|NP_442153.1| 1148.sll0202 gi|16331425|ref|NP_442153.1| SdR34 SgR67 gi|383323167|ref|YP_005384020.1| WP_010873451.1.11876 WP_010873451.1.1889 WP_010873451.1.18904 WP_010873451.1.33690 WP_010873451.1.35395 WP_010873451.1.47586 WP_010873451.1.99424 gi|383326336|ref|YP_005387189.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]