SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010873593.1.33690 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010873593.1.33690
Domain Number 1 Region: 6-184
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.13e-37
Family Pyruvate oxidase and decarboxylase Pyr module 0.0014
Further Details:      
 
Domain Number 2 Region: 404-557
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.04e-24
Family Pyruvate oxidase and decarboxylase PP module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010873593.1.33690
Sequence length 595
Comment 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [Synechocystis sp. PCC 6803]; AA=GCF_000270265.1; RF=na; TAX=1148; STAX=1148; NAME=Synechocystis sp. PCC 6803; strain=GT-S; AL=Complete Genome; RT=Major
Sequence
MVDFTNPNTLAASVLVETLFRLGLQQAVICPGSRSSPLTVALARHGGIDCVVSLDERSAS
FFALGHGKRTGQPVALVCTSGTAAANFLPAIIEAHYSQVPLLVLTGDRPPRLRHCRAGQT
IDQTKLYGHYPQWQTELALPEPNMDYCHYLRQTALHSWQKCFWPGLGVVHLNCPFDEPLV
PLEHARESLQHLAEEFSKEHFYRGLTTFTTMNRGEAISLPVNFSIFSFPSPQLDFSPLGL
ILVGVMPGGETPSLLTDILAIARGLGYPVLCDALCSLRNYDDGQTALITNYDFLIRCPRW
AEQLVPEQIIQIGELPTSKALRHWLGTIDCPRYILNFHGENLDPLQGQTIYLSASVAQVA
EYIHNQGFIPDAEQKNYAHSWLEKQRQSQTIIISALADAHTPLMVAQLAHCLPPQTNLFV
ANSLPVRWLEFFWPANGDHHRIFVNRGANGIDGTLSTAMGIAHRSRGETVLLTGDLSLLH
DSNGFLNQSQMRGNLTIILLNNNGGGIFQTLPIAQCEDVFETYFATPQGVDFGQLCRTYG
VEHKIITNLWDLKEQWPSNNSSPIRVLEIIGDRHQEAQWLKSLQAQFCCADSLIQ
Download sequence
Identical sequences L8APY5 Q55725
gi|383326479|ref|YP_005387333.1| gi|383323310|ref|YP_005384164.1| WP_010873593.1.11876 WP_010873593.1.1889 WP_010873593.1.18904 WP_010873593.1.33690 WP_010873593.1.35395 WP_010873593.1.47586 WP_010873593.1.99424 gi|16331568|ref|NP_442296.1| gi|383492363|ref|YP_005410040.1| gi|16331568|ref|NP_442296.1| 1148.sll0603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]