SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010873644.1.99424 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010873644.1.99424
Domain Number 1 Region: 8-46
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000628
Family Rho termination factor, N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010873644.1.99424
Sequence length 419
Comment hypothetical protein [Synechocystis sp. PCC 6803]; AA=GCF_000284135.1; RF=na; TAX=1080228; STAX=1148; NAME=Synechocystis sp. PCC 6803 substr. GT-I; strain=PCC 6803 substr. GT-I; AL=Complete Genome; RT=Major
Sequence
MAKEDRPSLKDMTLRQLRRVASECNISRYSRMRKSQLLAEVEKALNKPAPAPFSVKPLNR
PQEEQAVEASKFELGQDDKVGAPLTAVDEVLGDLPGGYGESRITLMPRDPQWAYAYWDIP
KEHKDALRSQGGQQLALRLYDVTDLDWQTASPHSVQEYLCDELAREWYLPIPVSDRDYAL
DIGYRTFDGRWLTLARSTPIRIPPVYPSDWVEEVFVTVNWDEDLQGKTIYQLVPPSKRPV
GVSTAVYDQVFDMAQGAEAMRMAGSLYGSMQHVPGSITHEQTLSSYVFPSGVGLWAAPNV
SGLNMSGIGMGYGLSSREFMASEAPVRPRQFWLVADAELIVYGATEPDATVTIGGRPIKL
NEDGTFRFQMSFQDGLIDYPIVAVAVDGEQTRNVHMKFTRETPSRNTNTKEEAVPEWFS
Download sequence
Identical sequences Q55770
gi|383323361|ref|YP_005384215.1| 1148.sll0185 gi|16331619|ref|NP_442347.1| gi|383492414|ref|YP_005410091.1| gi|383326530|ref|YP_005387384.1| gi|16331619|ref|NP_442347.1| WP_010873644.1.11876 WP_010873644.1.1889 WP_010873644.1.18904 WP_010873644.1.33690 WP_010873644.1.35395 WP_010873644.1.47586 WP_010873644.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]