SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010879040.1.27515 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010879040.1.27515
Domain Number 1 Region: 3-225
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 9.82e-21
Family Terpene synthases 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010879040.1.27515
Sequence length 271
Comment hypothetical protein, partial [Archaeoglobus fulgidus]; AA=GCF_000734035.1; RF=na; TAX=1344584; STAX=2234; NAME=Archaeoglobus fulgidus DSM 8774; strain=DSM 8774; AL=Complete Genome; RT=Major
Sequence
MDAIDLKRLSDFVRHRQNEDGGFAFCKPLPSTLAETFYAVSILTSIGEDVPRREKVVEFL
KSRIQTEINSLFYTLHSLNLLGEDLPDYSSFLLKRLEGLKAERKYLLSDGGVTATYTFLQ
PNALRDAYMISTLLHLYNRDVPEETKMLVRRYRRETEFGVGYGVKKPNLEETFYASYILR
DKAVISFVKSFESNGGFAKQPGGYPPYLEDTYYATSTLSLLSQRYSNPRTAEFIASLQNA
NGGFRRSIHGGISTLEDSYYAVEVLRRLEFR
Download sequence
Identical sequences A0A075WHG8 O28729
224325.AF1543 gi|11499138|ref|NP_070372.1| WP_010879040.1.27515 WP_010879040.1.34637 WP_010879040.1.46508 354208 AF1543_1_271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]