SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010879892.1.46508 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010879892.1.46508
Domain Number 1 Region: 6-87
Classification Level Classification E-value
Superfamily Vng1086c-like 2.09e-25
Family Vng1086c-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010879892.1.46508
Sequence length 92
Comment hypothetical protein [Archaeoglobus fulgidus]; AA=GCF_000008665.1; RF=representative genome; TAX=224325; STAX=2234; NAME=Archaeoglobus fulgidus DSM 4304; strain=DSM 4304; AL=Complete Genome; RT=Major
Sequence
MSGQFGKEELVHLHLLLFHVKKTFECYGIENEYFNEYDRLNISPVQIFRQKNEHQEAIFK
LCMGIMKAMGKEREAEELCKSLKRLAMVRATY
Download sequence
Identical sequences A0A075WHV9 A0A117KUU9 O30266
224325.AF2405 GR92 WP_010879892.1.27515 WP_010879892.1.34637 WP_010879892.1.46508 gi|11499981|ref|NP_071227.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]