SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010881521.1.96085 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010881521.1.96085
Domain Number 1 Region: 4-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000165
Family Thioltransferase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010881521.1.96085
Sequence length 90
Comment MULTISPECIES: glutaredoxin [Treponema]; AA=GCF_000246775.1; RF=na; TAX=491079; STAX=160; NAME=Treponema pallidum subsp. pertenue str. CDC2; strain=CDC2; AL=Chromosome; RT=Major
Sequence
MEKTLTLFGSNHCGQCATALEYLRSNHINFEYVDITGSGKNLKRFLKMRDSMPLFDDVKK
EGRIGIPCLSVNDGEQVFLGVEGLDLSAFR
Download sequence
Identical sequences A0A0A7X1R2 A0A0H3BJL6 F7XRR4 H6KUB9 O83111
243276.TP0072 455434.TPASS_0072 WP_010881521.1.101681 WP_010881521.1.10609 WP_010881521.1.11013 WP_010881521.1.13630 WP_010881521.1.177 WP_010881521.1.22706 WP_010881521.1.24110 WP_010881521.1.24144 WP_010881521.1.26337 WP_010881521.1.26670 WP_010881521.1.28216 WP_010881521.1.31174 WP_010881521.1.34567 WP_010881521.1.35526 WP_010881521.1.35589 WP_010881521.1.37724 WP_010881521.1.38137 WP_010881521.1.38252 WP_010881521.1.38852 WP_010881521.1.39803 WP_010881521.1.41302 WP_010881521.1.4135 WP_010881521.1.42739 WP_010881521.1.42752 WP_010881521.1.43796 WP_010881521.1.44774 WP_010881521.1.45335 WP_010881521.1.49513 WP_010881521.1.50901 WP_010881521.1.51333 WP_010881521.1.6132 WP_010881521.1.61389 WP_010881521.1.63356 WP_010881521.1.72815 WP_010881521.1.73546 WP_010881521.1.74079 WP_010881521.1.78381 WP_010881521.1.79283 WP_010881521.1.82112 WP_010881521.1.89996 WP_010881521.1.90600 WP_010881521.1.90779 WP_010881521.1.92130 WP_010881521.1.96085 WP_010881521.1.98226 WP_010881521.1.98956 WP_010881521.1.99137 WP_010881521.1.99367 gi|488657487|ref|YP_007935869.1| gi|384421623|ref|YP_005630982.1| gi|378981548|ref|YP_005229853.1| gi|15639066|ref|NP_218512.1| gi|378973639|ref|YP_005222245.1| gi|378974702|ref|YP_005223310.1| gi|408501975|ref|YP_006869419.1| gi|338706049|ref|YP_004672817.1| gi|378972573|ref|YP_005221177.1| gi|189025306|ref|YP_001933078.1| gi|512443566|ref|YP_008118845.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]