SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010881958.1.38852 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010881958.1.38852
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.2e-56
Family Glutathione peroxidase-like 0.00000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010881958.1.38852
Sequence length 188
Comment MULTISPECIES: peroxiredoxin [Treponema]; AA=GCF_001712895.1; RF=na; TAX=161; STAX=160; NAME=Treponema pallidum subsp. pallidum; strain=PT_SIF0697; AL=Chromosome; RT=Major
Sequence
MESLIGKRVIDFKLPAYVGGKFTEVSNASIKGSWAVFMFYPADFTFVCPTELADLARVYP
SFVEIGCKVYSVSTDSEYVHKAWADATDTIKNLPYEMISDKAGKLAGFFGVLLPDTWHAL
RGTFVVDPEGLVKAFEVHDMGIGRDADELLRKVQSAQFVAKHGDQVCPARWKPGAKTLKP
GIDLIGKI
Download sequence
Identical sequences A0A0A7X396 A0A0H3BKN1 F7XSW0 H6KTW7 O83522
gi|15639500|ref|NP_218950.1| gi|408502380|ref|YP_006869824.1| gi|378981991|ref|YP_005230296.1| gi|189025739|ref|YP_001933511.1| gi|512443972|ref|YP_008119251.1| 243276.TP0509 455434.TPASS_0509 gi|378974082|ref|YP_005222688.1| gi|378975143|ref|YP_005223751.1| gi|488657927|ref|YP_007936311.1| gi|384422020|ref|YP_005631379.1| WP_010881958.1.101681 WP_010881958.1.10609 WP_010881958.1.11013 WP_010881958.1.13630 WP_010881958.1.177 WP_010881958.1.22706 WP_010881958.1.24110 WP_010881958.1.24144 WP_010881958.1.26337 WP_010881958.1.26670 WP_010881958.1.28216 WP_010881958.1.31174 WP_010881958.1.34567 WP_010881958.1.35526 WP_010881958.1.35589 WP_010881958.1.37724 WP_010881958.1.38137 WP_010881958.1.38252 WP_010881958.1.38852 WP_010881958.1.39803 WP_010881958.1.41302 WP_010881958.1.4135 WP_010881958.1.42739 WP_010881958.1.42752 WP_010881958.1.43796 WP_010881958.1.44774 WP_010881958.1.45335 WP_010881958.1.49513 WP_010881958.1.50901 WP_010881958.1.51333 WP_010881958.1.6132 WP_010881958.1.61389 WP_010881958.1.63356 WP_010881958.1.72815 WP_010881958.1.73546 WP_010881958.1.74079 WP_010881958.1.78381 WP_010881958.1.79283 WP_010881958.1.82112 WP_010881958.1.89996 WP_010881958.1.90600 WP_010881958.1.90779 WP_010881958.1.92130 WP_010881958.1.96085 WP_010881958.1.98226 WP_010881958.1.98956 WP_010881958.1.99137 WP_010881958.1.99367 gi|338706469|ref|YP_004673237.1| gi|378973015|ref|YP_005221619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]