SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010883632.1.95540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010883632.1.95540
Domain Number 1 Region: 297-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-45
Family Ribonuclease PH domain 1-like 0.0000351
Further Details:      
 
Domain Number 2 Region: 12-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.37e-39
Family Ribonuclease PH domain 1-like 0.0000915
Further Details:      
 
Domain Number 3 Region: 453-560
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.57e-26
Family Ribonuclease PH domain 2-like 0.0002
Further Details:      
 
Domain Number 4 Region: 137-229
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.57e-24
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 5 Region: 610-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.82e-19
Family Cold shock DNA-binding domain-like 0.00064
Further Details:      
 
Domain Number 6 Region: 548-622
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.96e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0041
Further Details:      
 
Domain Number 7 Region: 226-326
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000222
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010883632.1.95540
Sequence length 694
Comment polyribonucleotide nucleotidyltransferase [Chlamydia pneumoniae]; AA=GCF_001007145.1; RF=na; TAX=83558; STAX=83558; NAME=Chlamydia pneumoniae; AL=Complete Genome; RT=Major
Sequence
MNFQTISINLTEGKILVFETGKIARQANGAVLVRSGETCVFASACAVDLDDKVDFLPLRV
DYQEKFSSTGKTLGGFIKREGRPSEKEILVSRLIDRSLRPSFPYRLMQDVQVLSYVWSYD
GQVLPDPLAICAASAALAISDIPQSNIVAGVRIGCIDNQWVINPTKTELASSTLDLVLAG
TENAILMIEGHCDFFTEEQVLDAIEFGHKHIVTICKRLQLWQEEVGKSKNLSAVYPLPAE
VLTAVKECAQDKFTELFNIKDKKVHAATAHEIEENILEKLQREDDDLFSSFNIKAACKTL
KSDTMRALIRDREIRADGRSLTTVRPITIETSYLPRTHGSCLFTRGETQTLAVCTLGSEA
MAQRYEDLNGEGLSKFYLQYFFPPFSVGEVGRIGSPGRREIGHGKLAEKALSHALPDSAT
FPYTIRIESNITESNGSSSMASVCGGCLALMDAGVPISSPIAGIAMGLILDDQGAIILSD
ISGLEDHLGDMDFKIAGSGKGITAFQMDIKVEGITPAIMKKALSQAKQGCNDILNIMNEA
LSAPKADLSQYAPRIETMQIKPTKIASVIGPGGKQIRQIIEETGVQIDVNDLGVVSISAS
SASAINKAKEIIEGLVGEVEVGKTYRGRVTSVVAFGAFVEVLPGKEGLCHISECSRQRIE
NISDVVKEGDIIDVKLLSINEKGQLKLSHKATLE
Download sequence
Identical sequences A0A0F7WG69 Q9Z6R0
NP_225193.1.662 WP_010883632.1.15326 WP_010883632.1.24544 WP_010883632.1.35099 WP_010883632.1.46341 WP_010883632.1.48548 WP_010883632.1.8178 WP_010883632.1.91433 WP_010883632.1.95540 gi|15618907|ref|NP_225193.1| gi|15836530|ref|NP_301054.1| gi|16752027|ref|NP_445393.1| 115711.CP0855 115713.CPn0999 138677.CPj0999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]