SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010886278.1.9355 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010886278.1.9355
Domain Number 1 Region: 200-360
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 2.75e-73
Family RalF, C-terminal domain 0.0000256
Further Details:      
 
Domain Number 2 Region: 11-196
Classification Level Classification E-value
Superfamily Sec7 domain 3.66e-55
Family Sec7 domain 0.00000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010886278.1.9355
Sequence length 462
Comment hypothetical protein [Rickettsia prowazekii]; AA=GCF_001602215.1; RF=na; TAX=782; STAX=782; NAME=Rickettsia prowazekii; strain=Naples-1; AL=Complete Genome; RT=Major
Sequence
MGDKMDSLLKNEVIKLFNDKPKSGIARIKKWCTDNNQDFIAETAKIFYEEKSNLNLEFVG
DYLGTDGVDNQKVLESFTKQFDFKEKDYLESLRRFLQSFKLPGEAQKIDRLVESFGTHYY
EQNLNIDINSKDAAYILAYQTIMLNTDLHNPSIAKSKKMTFEQLKNNLKGTNESKNFNDN
FLKKIYDEIEAKPFKLNFVDSSPGYQINNISSQNDKTFKQLNQFLEEKRNIQNIFPKLQN
NNLTIEFKNPKTFLSKFTGYKGSVIIKDEKSGAAEIQVYKPSIFSRWFLGEKSKIIIQPL
REEGRQPSEQSLKLAAQITASFETKVTSIKATYDYLKEDLKSQYDNIRNPKKELEKASAI
AEGHKNIKYITEIVHQINQPVKNAVAVFSSTISVEPQISKSDLPIKPPQLPVPKSIPNVV
KKAAKDISKQIPHERDKHKEELAKALEIQRRKIEKQNSGRVV
Download sequence
Identical sequences D5AWV9 Q9ZDF5
gi|386082219|ref|YP_005998796.1| 272947.RP374 gi|15604241|ref|NP_220757.1| NP_220757.1.81248 WP_010886278.1.19079 WP_010886278.1.38548 WP_010886278.1.39958 WP_010886278.1.6643 WP_010886278.1.75108 WP_010886278.1.82014 WP_010886278.1.8209 WP_010886278.1.9355 WP_010886278.1.96644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]