SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010890471.1.1784 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010890471.1.1784
Domain Number 1 Region: 164-273
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.000000000201
Family MRR-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010890471.1.1784
Sequence length 348
Comment hypothetical protein [Halobacterium salinarum]; AA=GCF_000069025.1; RF=na; TAX=478009; STAX=2242; NAME=Halobacterium salinarum R1; strain=DSM 671 = R1; AL=Complete Genome; RT=Major
Sequence
MTTDEPLPDGYADRLCSLTTTVESLRGTLKTDHTLSTDQRMFAHRLLYLANEPITEAKRL
LSEPDPDDDSADDRPVDSTVEYAEAVTQIEQQLSWLLRSLHAGQPAAHHYDEAPVEKLKT
ALEYATALRDILPAVPDDSSVVADLEDVSVDEVDPNVGGRGESDGRWLEYQLQRALGRWG
YRAARRQHLFSLEVDVVATRRDKRQEPSDWIVGQCKDWTDDPITPAALFRLCTVAFACRA
MPVLCHTTELTPRAEKLAREFEVRVLSLTDLERAELPAPQVAKPTLELDEWRPQYRARDY
RGSLPVLFWSESGKRFSYVPGFAPAGTDANYEPIEDDTDDDTHPAADH
Download sequence
Identical sequences B0R8Y0 O52014
gi|10803657|ref|NP_046055.1|NC_001869 gi|169237299|ref|YP_001690505.1|NC_010366 gi|169237342|ref|YP_001690547.1|NC_010367 WP_010890471.1.1784 WP_010890471.1.50382 gi|169237299|ref|YP_001690505.1| gi|169237342|ref|YP_001690547.1| gi|10803657|ref|NP_046055.1| 478009.OE7207F 478009.OE8039F 64091.VNG7110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]