SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010903758.1.1784 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010903758.1.1784
Domain Number 1 Region: 63-225,353-492
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.04e-47
Family Tandem AAA-ATPase domain 0.0000435
Further Details:      
 
Domain Number 2 Region: 568-700
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 2.28e-27
Family XPF/Rad1/Mus81 nuclease 0.000053
Further Details:      
 
Domain Number 3 Region: 711-778
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000000000000826
Family Hef domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010903758.1.1784
Sequence length 784
Comment Hef nuclease [Halobacterium salinarum]; AA=GCF_000069025.1; RF=na; TAX=478009; STAX=2242; NAME=Halobacterium salinarum R1; strain=DSM 671 = R1; AL=Complete Genome; RT=Major
Sequence
MSEEMGYVDHPMLADGVIEARQYQLQLAAAARQGHTLVCLPTGLGKTTVSLLVTAYRLAD
DAGGTALLLAPTKPLVEQHAGFYREALAIPDDDVVVFTGETRPDDRRAAWTDARVVVATP
QVVENDLVGGRIDMDDVVHCTFDECHRATGDYAYTYVAERYHADAAAPLVTAMSASPGGT
EAEIRTVCENLGVGNVEVMTEDDADVGEHTHDTDVQWERVTLPEEILEVRDAINDVIEDR
LAKLREIGVTKASSPDISQKDLNEIRARLQQLIDDDDSDGYQGMSVHAEVMKLKRAVELV
ETQSVESVRRYFERQRNAANTAGASKASQRLVSEPAVKRAMRTAREFDGLHPKFRQARML
LAETLGIEDGDRVIVFTESRDTAEALTAFLGEHFDTRRFVGQGDADGSDGMTQTEQRETL
AEFRNGDFEVLVSTSVAEEGLDVPEVDLVLFFEPVPTAIRSVQRKGRTGRQTAGRVVVLL
AEDTRDEAYFWISRRREQEMTEELQSLKGRADELETELGGDGAQQALDEFGDAEAAGEEP
AAPAPEDVSDGEDTEGVAARVDGAGEAVEVVVDQRELDSTIARELSKRDGVETRLETLAV
GDYVVSDRVAVERKSHSDFMDTLLGSERSIFEQAKELARQYTRPVLVVEGDGDLYAERNV
HPNAVRSAMASLAVDWGLSVMHTNGEGDTTEMIETIAEREQTTNDRAVSAHGEKAAKTQG
EQQEYVVSSITDVGPVTARSLLDTFGSVEAVMTASEDELTAADGVGAVTAERIRGVVGTE
YQPE
Download sequence
Identical sequences B0R7P3 Q9HMW5
WP_010903758.1.1784 WP_010903758.1.50382 478009.OE4310F 64091.VNG2356G gi|169236908|ref|YP_001690108.1| gi|15791152|ref|NP_280976.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]