SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010906364.1.91600 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_010906364.1.91600
Domain Number - Region: 13-85
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000581
Family Legume lectins 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010906364.1.91600
Sequence length 926
Comment hypothetical protein [Lactococcus lactis]; AA=GCF_002148215.1; RF=na; TAX=44688; STAX=1358; NAME=Lactococcus lactis subsp. lactis bv. diacetylactis; strain=FM03; AL=Complete Genome; RT=Major
Sequence
MNGQAKTISASAKGIPQPSNNNFVDFTMSYNGTTKVMSITYGGQTWTQNVSSFIGTNQAM
SFSIAASTGAQMNLQQLRNVNFTYTVAQGTVIANYVDEQGNTIAQQETTSGDIDTPYVTS
QKTIPGYTFKASNGAATSGNYAANDQTVNYVYTRNQGSIDVTYIDQTTGQTLSKKDLSGG
TGDSSNYTTTDTIKSYTDAGYELVSDNYPSGGTVFTDTAQHYVVNLKQKLVVSSEQKQVN
ETIQYVYEDGSKAADDYNAPPLNFTRSVTTNQVTGEKTYGDWQAQNGDSFGEVVSPTIKG
ETADQLKIDAISGITANSADIQKKVVYKRNQGTIDVTYIDETTGQVLTKKDLSGGTDDPS
NYTTADDIKSYTDKGYELVSDDYPSGGTVFTDEPQHYVVKLKHGLTESTDKKAVNQVIHY
VYEGGGEAATDHNATVDFSRTITTDRVTNDKTYGDWTADNGDSFASVTSPVIDGYTADQL
KVSEMTGITADTEDISVTVTYTRNQGTIDITYIDQTTGQTLSKKDLSGGTGDDSGYTTAD
TIKSYTDKGYELISDDYPEDGTKFADDPQHYIVRLKHGLTEVTENKTVNQVIHYVYEGGG
EAATDHNATVVFSQTITTDKVTGEKTYSDWTADNGDSFASVTSPVIDGYTADQLKVSEMT
GITVDTEDISVTVTYTRNQGTIDVTYIDETTGKILTTKDLSGGTGDDSGYTTADTIKSYT
DKGYELVSNDYPEDGTKFADDPQHYIVRLKHGTVVETENKSVNEVIHYVYDNGDKAADNY
KATIVFSRTITTDKVTGEKTYSDWTADNGGRFAAVLSPIIKDYIASQLKVDEMTGITVDT
ADIERIVVYHKVPAGIIVPPVHPDKPSQPSNNQSKIPTAKAVKDSKPTDVLPSTGDSQKS
QIVLTLLGIMAVIISPLALLLRRRKQ
Download sequence
Identical sequences Q9CDN9
NP_268337.1.16647 WP_010906364.1.39480 WP_010906364.1.39902 WP_010906364.1.55618 WP_010906364.1.56612 WP_010906364.1.70979 WP_010906364.1.7442 WP_010906364.1.91600 KR68 gi|15674162|ref|NP_268337.1| 272623.L39650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]