SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010907224.1.15732 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010907224.1.15732
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.96e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.006
Further Details:      
 
Domain Number 2 Region: 85-200
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000000369
Family Glutathione S-transferase (GST), C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010907224.1.15732
Sequence length 202
Comment glutathione S-transferase [Pasteurella multocida]; AA=GCF_002023845.1; RF=na; TAX=115545; STAX=747; NAME=Pasteurella multocida subsp. septica; strain=CIRMBP-0749; AL=Scaffold; RT=Major
Sequence
MYQLYFNPPKSSWSLRVWVLLKELAIPFEPKIVRYLDDLSEQRQQFKAFSPTSKIPVLHA
DGVVIWDSLAIIEFLAESYPHVWAQDKATRAWSRSACAEMHSGFENLREMCDFAPLARKP
LQEIPAVLSQELARLNQLLEEGLTAFGGAFLAGDRFTAVDAFFLPVMARIETYALHQYFS
PQVLEYQKMLVNSASFQTWLTL
Download sequence
Identical sequences A0A290M107 Q9CKQ5
gi|15603416|ref|NP_246490.1| gi|383311402|ref|YP_005364212.1| 272843.PM1551 WP_010907224.1.12311 WP_010907224.1.15732 WP_010907224.1.19996 WP_010907224.1.40210 WP_010907224.1.41297 WP_010907224.1.41351 WP_010907224.1.41667 WP_010907224.1.45422 WP_010907224.1.4808 WP_010907224.1.53852 WP_010907224.1.55074 WP_010907224.1.57956 WP_010907224.1.58111 WP_010907224.1.6219 WP_010907224.1.62389 WP_010907224.1.66990 WP_010907224.1.81885 WP_010907224.1.8281 WP_010907224.1.88402 WP_010907224.1.89773 WP_010907224.1.92478 WP_010907224.1.93940 WP_010907224.1.9746 WP_010907224.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]