SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010907414.1.8281 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010907414.1.8281
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.73e-37
Family ArsC-like 0.0000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010907414.1.8281
Sequence length 134
Comment arsenate reductase (glutaredoxin) [Pasteurella multocida]; AA=GCF_002059225.1; RF=na; TAX=44283; STAX=747; NAME=Pasteurella multocida subsp. multocida; strain=CIRMBP-0884; AL=Complete Genome; RT=Major
Sequence
MNITIYHNSNCGTSRNVLALIRHAGIEPQVIEYLKNPPSETTLRNLIKRMGITPRQLLRT
NVVPYETLGLQNEKLSDDELISAMLREPILINRPIVVSEKGVKLCRPSETVLAFLPPFAI
PFVKEDGEIINHKE
Download sequence
Identical sequences Q9CJQ0
272843.PM1944 gi|15603809|ref|NP_246883.1| WP_010907414.1.12311 WP_010907414.1.15732 WP_010907414.1.19996 WP_010907414.1.40210 WP_010907414.1.45422 WP_010907414.1.4808 WP_010907414.1.53852 WP_010907414.1.6219 WP_010907414.1.62389 WP_010907414.1.66990 WP_010907414.1.81885 WP_010907414.1.8281 WP_010907414.1.89773 WP_010907414.1.9746 WP_010907414.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]