SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010936985.1.96037 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_010936985.1.96037
Domain Number - Region: 7-23,73-99
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00272
Family Di-heme elbow motif 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010936985.1.96037
Sequence length 105
Comment MULTISPECIES: zinc-binding protein [Dehalococcoides]; AA=GCF_001889305.1; RF=na; TAX=61435; STAX=61435; NAME=Dehalococcoides mccartyi; strain=CG3; AL=Complete Genome; RT=Major
Sequence
MAYQDKEIQCADCGASFTFTASEQELYASRGYTNDPKRCVSCRQARKAERGGSTGGFGGM
SRGPARQMFQAVCAQCGQDTEVPFEPRQGRPVYCSNCYNRVKGGR
Download sequence
Identical sequences A0A076IBT1 A0A0C6EEU8 A0A0V8M2X9 D2BIP7 Q3Z6Z1
WP_010936985.1.26930 WP_010936985.1.32090 WP_010936985.1.40429 WP_010936985.1.46065 WP_010936985.1.4711 WP_010936985.1.64064 WP_010936985.1.65481 WP_010936985.1.69666 WP_010936985.1.96037 WP_010936985.1.98386 gi|561113307|ref|YP_008856368.1| gi|57233900|ref|YP_182008.1| gi|270308467|ref|YP_003330525.1| 243164.DET1296 311424.DhcVS_1080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]