SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010945400.1.78970 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010945400.1.78970
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4e-50
Family Ribonuclease PH domain 1-like 0.0000128
Further Details:      
 
Domain Number 2 Region: 292-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.48e-46
Family Ribonuclease PH domain 1-like 0.0000117
Further Details:      
 
Domain Number 3 Region: 144-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.02e-30
Family Ribonuclease PH domain 2-like 0.0011
Further Details:      
 
Domain Number 4 Region: 449-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.71e-28
Family Ribonuclease PH domain 2-like 0.0000959
Further Details:      
 
Domain Number 5 Region: 606-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.74e-22
Family Cold shock DNA-binding domain-like 0.0000977
Further Details:      
 
Domain Number 6 Region: 238-319
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 4.18e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0026
Further Details:      
 
Domain Number 7 Region: 553-620
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.67e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010945400.1.78970
Sequence length 712
Comment polyribonucleotide nucleotidyltransferase [[Haemophilus] ducreyi]; AA=GCF_000007945.1; RF=representative genome; TAX=233412; STAX=730; NAME=Haemophilus ducreyi 35000HP; strain=35000HP; AL=Complete Genome; RT=Major
Sequence
MTPIVKQFKYGQHTVTLETGAIARQATAAVMASMDDTTVFVSVVAKKEVKEGQDFFPLTV
NYQERTYAAGRIPGGFFKREGRPSENETLIARLIDRPIRPLFPEGFFNEIQIVATVVSVN
PQISPDLVAMIGASAALSLSGVPFNGPIGAARVGFINDQFVLNPTITEQKQSRLDLVVAG
TDKAVLMVESEADILSEEQMLAAVVFGHQQQQIVIENIKEFVKEAGKPRWDWQPAEANTA
LINQVKALAETRIGDAYRITEKQARYEQIDAIKADVIAQLTAQDETISEGAIIDIITALE
SSVVRGRILAGEPRIDGRTVDTVRALNICTGVLPRTHGSAIFTRGETQALAVATLGTERD
AQIIDELTGEKSDRFLFHYNFPPYSVGETGMIGSPKRREIGHGRLAKRGVLAVMPSAEEF
PYVVRVVSEITESNGSSSMASVCGASLALMDAGVPIKATVAGIAMGLVKEDEKFVVLSDI
LGDEDHLGDMDFKVAGTRKGITALQMDIKIEGITPEIMHIALNQAKGARMHILNVMEQAL
PAPRADLSDFAPRIHTMKIDPKKIKDVIGKGGAVIRSLTEETGTSIDIDDDGTVKIAATD
NNAAKMVMSRIEEIVAEVEVNAIYTGKVSRVVDFGAFVTILGGKEGLVHISQITDARVER
VSDYLSVGQEVNVKVVEIDRQNRIRLTMKDLDNNLSTNVTPEAVVQEESTEN
Download sequence
Identical sequences Q7VL91
gi|33152626|ref|NP_873979.1| 233412.HD1588 WP_010945400.1.19715 WP_010945400.1.69448 WP_010945400.1.78970 WP_010945400.1.84729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]