SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010947666.1.28814 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010947666.1.28814
Domain Number 1 Region: 198-349
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 3.92e-74
Family RalF, C-terminal domain 0.0000000435
Further Details:      
 
Domain Number 2 Region: 4-194
Classification Level Classification E-value
Superfamily Sec7 domain 2.22e-60
Family Sec7 domain 0.00000000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010947666.1.28814
Sequence length 374
Comment guanine nucleotide exchange protein [Legionella pneumophila]; AA=GCF_900064195.1; RF=na; TAX=446; STAX=446; NAME=Legionella pneumophila; strain=2532STDY5467521; AL=Scaffold; RT=Major
Sequence
MHPEIEKAQREIIEAFNAKPKNGINKIKEICEQYKISPNEEIAEFFHQQRKNLDLEAVGD
YLSSPEAENQQVLKAFTSQMNFNGQSFVEGLRTFLKTFKLPGEAQKIDRLVQSFSGAYFQ
QNPDVVSNADAAYLLAFQTIMLNTDLHNPSIPEKNKMTVDGLKRNLRGGNNGGDFDAKFL
EELYSEIKAKPFELNFVKTSPGYELTSTTLNKDSTFKKLDSFLHSTDVNINTVFPGIGDN
VKTTVDQPKSWLSFFTGYKGTITLTDNKTSAQATIQVYTPNIFSKWLFGEQPRVIIQPGQ
TKESIDLAAKAAADFSSPVKNFKATYDYEVGDLIKAYDNQKKLITIERNLALKEGVPKDP
DAEMQKEKGRQLKF
Download sequence
Identical sequences A0A2J9NHZ7 G8UZ12 Q5ZU58 Q8RT31
gi|470181905|ref|YP_007567780.1| WP_010947666.1.100881 WP_010947666.1.101385 WP_010947666.1.10160 WP_010947666.1.11666 WP_010947666.1.1188 WP_010947666.1.12035 WP_010947666.1.12661 WP_010947666.1.14235 WP_010947666.1.15016 WP_010947666.1.16078 WP_010947666.1.16593 WP_010947666.1.16748 WP_010947666.1.16962 WP_010947666.1.17857 WP_010947666.1.19321 WP_010947666.1.19554 WP_010947666.1.20369 WP_010947666.1.2062 WP_010947666.1.2085 WP_010947666.1.21466 WP_010947666.1.21493 WP_010947666.1.21924 WP_010947666.1.22734 WP_010947666.1.22766 WP_010947666.1.2333 WP_010947666.1.23459 WP_010947666.1.24053 WP_010947666.1.24333 WP_010947666.1.2441 WP_010947666.1.24636 WP_010947666.1.26718 WP_010947666.1.27038 WP_010947666.1.27501 WP_010947666.1.27674 WP_010947666.1.28814 WP_010947666.1.29318 WP_010947666.1.29802 WP_010947666.1.30583 WP_010947666.1.30653 WP_010947666.1.30822 WP_010947666.1.31291 WP_010947666.1.32608 WP_010947666.1.32615 WP_010947666.1.32659 WP_010947666.1.33479 WP_010947666.1.33708 WP_010947666.1.35118 WP_010947666.1.35787 WP_010947666.1.36420 WP_010947666.1.37108 WP_010947666.1.37274 WP_010947666.1.37932 WP_010947666.1.3819 WP_010947666.1.38444 WP_010947666.1.38679 WP_010947666.1.40870 WP_010947666.1.41185 WP_010947666.1.41378 WP_010947666.1.41486 WP_010947666.1.44619 WP_010947666.1.44866 WP_010947666.1.45024 WP_010947666.1.46042 WP_010947666.1.46096 WP_010947666.1.47823 WP_010947666.1.47956 WP_010947666.1.48346 WP_010947666.1.51153 WP_010947666.1.51428 WP_010947666.1.51956 WP_010947666.1.52283 WP_010947666.1.52706 WP_010947666.1.52905 WP_010947666.1.53250 WP_010947666.1.53261 WP_010947666.1.53669 WP_010947666.1.53795 WP_010947666.1.53844 WP_010947666.1.54355 WP_010947666.1.57055 WP_010947666.1.57468 WP_010947666.1.58541 WP_010947666.1.58606 WP_010947666.1.58931 WP_010947666.1.59227 WP_010947666.1.59576 WP_010947666.1.60239 WP_010947666.1.60770 WP_010947666.1.61895 WP_010947666.1.62077 WP_010947666.1.63282 WP_010947666.1.636 WP_010947666.1.64335 WP_010947666.1.64388 WP_010947666.1.64512 WP_010947666.1.64856 WP_010947666.1.66209 WP_010947666.1.66299 WP_010947666.1.68412 WP_010947666.1.68702 WP_010947666.1.69197 WP_010947666.1.70346 WP_010947666.1.70691 WP_010947666.1.7124 WP_010947666.1.71556 WP_010947666.1.73029 WP_010947666.1.73915 WP_010947666.1.74438 WP_010947666.1.75353 WP_010947666.1.75911 WP_010947666.1.76298 WP_010947666.1.76893 WP_010947666.1.77472 WP_010947666.1.77852 WP_010947666.1.77866 WP_010947666.1.79027 WP_010947666.1.79030 WP_010947666.1.79957 WP_010947666.1.80678 WP_010947666.1.80733 WP_010947666.1.80817 WP_010947666.1.81970 WP_010947666.1.82765 WP_010947666.1.83499 WP_010947666.1.8363 WP_010947666.1.84081 WP_010947666.1.85699 WP_010947666.1.86349 WP_010947666.1.86607 WP_010947666.1.87629 WP_010947666.1.87656 WP_010947666.1.88081 WP_010947666.1.89135 WP_010947666.1.89155 WP_010947666.1.89171 WP_010947666.1.90392 WP_010947666.1.90650 WP_010947666.1.91256 WP_010947666.1.91480 WP_010947666.1.93200 WP_010947666.1.94508 WP_010947666.1.9567 WP_010947666.1.96018 WP_010947666.1.96198 WP_010947666.1.97528 WP_010947666.1.97598 WP_010947666.1.97635 WP_010947666.1.98470 WP_010947666.1.98928 YP_095966.1.86292 gi|378777802|ref|YP_005186240.1| gi|509151256|ref|YP_008063630.1| 272624.lpg1950 gi|52842167|ref|YP_095966.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]