SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010975375.1.787 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010975375.1.787
Domain Number 1 Region: 55-240
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 9.68e-54
Family Methylesterase CheB, C-terminal domain 0.0000693
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010975375.1.787
Sequence length 405
Comment chemotaxis protein-glutamate methylesterase [Sinorhizobium meliloti]; AA=GCF_000346065.1; RF=na; TAX=1286640; STAX=382; NAME=Sinorhizobium meliloti 2011; strain=2011; AL=Complete Genome; RT=Major
Sequence
MATIIRIRHDPLISADISAPIVPAGKIFPSRLRFSRDRTYPFVERFCPMEHTMGRRDVIA
IGGSLGAVAALKHLLGKLPGDFAAAVFVVIHVGARGKDLLAEILNAHSGIPVTTAVDGEA
VERRHVYVAPADHHLLVIDGVIRLGRGPRENLARPAVDPLFRSVGLNYGPRAVAIVLTGM
LNDGAAGLADLKRCGGVTVVQNPSDAVAPDMPMGALRASDVDYRAPLEDLAALLVELTGE
EAGPPILVPAEIRLEVDIALGLQIGSETMLTIANPVPISCPACGGVLSQIKSWPPLRFRC
QVGHAYTSEALAAASEGAVDEALRVALRIIEERVTLSEKMAQDAHRSGFAAAAAANRRRA
NEGREHAETLRRAIIGSGTDATAGELEDADLAVAKHPDTIDPESS
Download sequence
Identical sequences Q92W50
gi|16264243|ref|NP_437035.1|NC_003078 gi|470185871|ref|YP_007613243.1|NC_020560 266834.SM_b20514 NP_437035.1.96377 WP_010975375.1.4234 WP_010975375.1.787 gi|470185871|ref|YP_007613243.1| gi|16264243|ref|NP_437035.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]